Protein on Demand™ ORC4 Recombinant Protein (Rat) (OPCA273499)

Datasheets/Manuals	Printable datasheet for OPCA273499

Product Info
Predicted Species Reactivity	Rat
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MSNRKSKNNIHAECLSQVQRILRERFCHHTPHSNLFGVQVQYKHLIELLKRTAIYGESNSLLIVGPRGSGKTTLLNHALKELMQIGDMSENVLQVHLNGLLQTNDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALQKGNRTSSCPVIFILDEFDLFAHQKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFDFPQYLKIFKEQLSLPAEFPDKIFAEKWNENAHCLSEDSTVLEVLQKHFNVNKNLQSLHMLLMLALNRVTVTHPFMTSADLMEAQHLCSLDAKASIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFIQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSVNSQREYQLVKLLLDNTQIMNALQKYSNCPTDVRQWATSSLSWL
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-434

Gene Full Name	origin recognition complex, subunit 4
NCBI Gene Id	295596
Protein Name	origin recognition complex subunit 4
Description of Target	mouse homolog plays a role in initiation of DNA replication [RGD, Feb 2006]
Uniprot ID	Q6P9Z8
Protein Size (# AA)	434