ORAI1 Antibody - middle region (ARP50118_P050)

Catalog No: ARP50118_P050

WB Suggested Anti-ORAI1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ORAI1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 86%; Yeast: 77%
• Peptide Sequence: Synthetic peptide located within the following region: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ORAI1 (ARP50118_P050) antibody is Catalog # AAP50118 (Previous Catalog # AAPS28308)
• Reference: Peel,S.E., (2008) Am. J. Respir. Cell Mol. Biol. 38 (6), 744-749

Target Info

• Gene Symbol: ORAI1
• Gene Full Name: ORAI calcium release-activated calcium modulator 1
• Alias Symbols: IMD9, TAM2, ORAT1, CRACM1, TMEM142A
• NCBI Gene Id: 84876
• Protein Name: Calcium release-activated calcium channel protein 1
• Description of Target: ORAI1 belongs to the Orai family. ORAI1 (CRACM1) is a plasma membrane protein essential for store-operated calcium entry. Defects in ORAI1 are a cause of severe combined immunodeficiency with CRAC channel dysfunction (CRAC-SCID).CRACM1 is a plasma membrane protein essential for store-operated calcium entry (Vig et al., 2006 [PubMed 16645049]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-331 BC075831.1 1-331 332-844 BC013386.1 220-732 845-990 BC075831.1 845-990 991-1490 BG574128.1 52-551 1491-1496 AK027372.1 1235-1240
• Uniprot ID: Q96D31
• Protein Accession #: NP_116179
• Nucleotide Accession #: NM_032790
• Protein Size (# AA): 301
• Molecular Weight: 33kDa
• Protein Interactions: UBQLN1; UBC; TRPC3; TRPC6;