Search Antibody, Protein, and ELISA Kit Solutions

OR5P3 Antibody - C-terminal region (ARP71200_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP71200_P050-FITC Conjugated

ARP71200_P050-HRP Conjugated

ARP71200_P050-Biotin Conjugated

Gene Symbol:
OR5P3
NCBI Gene Id:
120066
Swissprot Id:
Q8WZ94
Protein Accession #:
NP_703146
Nucleotide Accession #:
NM_153445
Alias Symbols:
JCG1
Replacement Item:
This antibody may replace item sc-109715 from Santa Cruz Biotechnology.
Description of Target:
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Protein Size (# AA):
311
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OR5P3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OR5P3.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5P3
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: ILITILKMHSTKGRHKAFSTCTSHLTAVTLFYGTITFIYVMPKSSYSTDQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-OR5P3 (ARP71200_P050) antibody is Catalog # AAP71200
Datasheets/Manuals:
Printable datasheet for anti-OR5P3 (ARP71200_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...