SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP59695_P050
Price: $0.00
SKU
ARP59695_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-OR1G1 (ARP59695_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human OR1G1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 85%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: FSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSSLRKLIWVRK
Concentration0.5 mg/ml
Blocking PeptideFor anti-OR1G1 (ARP59695_P050) antibody is Catalog # AAP59695 (Previous Catalog # AAPP45865)
Sample Type Confirmation

OR1G1 is supported by BioGPS gene expression data to be expressed in A549

Gene SymbolOR1G1
Gene Full NameOlfactory receptor, family 1, subfamily G, member 1
Alias SymbolsOR1G2, OR17-130, OR17-209
NCBI Gene Id8390
Protein NameOlfactory receptor 1G1
Description of TargetOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Uniprot IDP47890
Protein Accession #NP_003546
Nucleotide Accession #NM_003555
Protein Size (# AA)313
Molecular Weight35kDa
Protein InteractionsOBP2A;
  1. What is the species homology for "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OR1G1 Antibody - C-terminal region (ARP59695_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    This target may also be called "OR1G2, OR17-130, OR17-209" in publications.

  5. What is the shipping cost for "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OR1G1 Antibody - C-terminal region (ARP59695_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OR1G1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OR1G1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OR1G1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OR1G1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OR1G1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OR1G1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OR1G1 Antibody - C-terminal region (ARP59695_P050)
Your Rating