Search Antibody, Protein, and ELISA Kit Solutions

OPHN1 Antibody - middle region (ARP84708_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
oligophrenin 1
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
This gene encodes a Rho-GTPase-activating protein that promotes GTP hydrolysis of Rho subfamily members. Rho proteins are important mediators of intracellular signal transduction, which affects cell migration and cell morphogenesis. Mutations in this gene are responsible for OPHN1-related X-linked mental retardation with cerebellar hypoplasia and distinctive facial dysmorhphism.
Protein Size (# AA):
Molecular Weight:
34 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OPHN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OPHN1.
The immunogen is a synthetic peptide directed towards the middle region of human OPHN1
Peptide Sequence:
Synthetic peptide located within the following region: NASDLLIKPLENFRKEQIGFTKERKKKFEKDGERFYSLLDRHLHLSSKKK
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-OPHN1 (ARP84708_P050) antibody is Catalog # AAP84708
Printable datasheet for anti-OPHN1 (ARP84708_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...