ONECUT1 Antibody - middle region : HRP (ARP38481_P050-HRP)

Catalog No: ARP38481_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ONECUT1 (ARP38481_P050-HRP) antibody is Catalog # AAP38481 (Previous Catalog # AAPP23190)
• Reference: Jiang,X., (2008) Oncol. Rep. 19 (1), 157-163
• Publications:

  Yuan, X.-W. et al. Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition. J. Biol. Chem. 288, 31206-16 (2013). WB, IHC, Human, Rat, Dog, Pig, Horse, Rabbit, Bovine, Mouse, Zebrafish 24022481

Target Info

• Gene Symbol: ONECUT1
• Gene Full Name: One cut homeobox 1
• Alias Symbols: HNF6, HNF-6, HNF6A
• NCBI Gene Id: 3175
• Protein Name: Hepatocyte nuclear factor 6
• Description of Target: ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
• Uniprot ID: Q9UBC0
• Protein Accession #: NP_004489
• Nucleotide Accession #: NM_004498
• Protein Size (# AA): 465
• Molecular Weight: 51kDa
• Protein Interactions: NR0B2; KAT2B; FOXA2; CREBBP; NR3C1; FOXA1;