Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ONECUT1 antibody - middle region (ARP38481_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP38481_P050-FITC Conjugated

ARP38481_P050-HRP Conjugated

ARP38481_P050-Biotin Conjugated

Gene Symbol:
ONECUT1
NCBI Gene Id:
3175
Official Gene Full Name:
One cut homeobox 1
Protein Name:
Hepatocyte nuclear factor 6
Swissprot Id:
Q9UBC0
Protein Accession #:
NP_004489
Nucleotide Accession #:
NM_004498
Alias Symbols:
HNF-6, HNF6, HNF6A
Replacement Item:
This antibody may replace item sc-120850 from Santa Cruz Biotechnology.
Description of Target:
ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
Protein Size (# AA):
465
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ONECUT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ONECUT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-ONECUT1 (ARP38481_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NR0B2; KAT2B; FOXA2; CREBBP; NR3C1; FOXA1;
Blocking Peptide:
For anti-ONECUT1 (ARP38481_P050) antibody is Catalog # AAP38481 (Previous Catalog # AAPP23190)
Datasheets/Manuals:
Printable datasheet for anti-ONECUT1 (ARP38481_P050) antibody
Target Reference:
Jiang,X., (2008) Oncol. Rep. 19 (1), 157-163
Publications:

Yuan, X.-W. et al. Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition. J. Biol. Chem. 288, 31206-16 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24022481

Tell us what you think about this item!

Write A Review
    Please, wait...