Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP38481_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP38481_P050-FITC Conjugated

ARP38481_P050-HRP Conjugated

ARP38481_P050-Biotin Conjugated

ONECUT1 Antibody - middle region (ARP38481_P050)

Catalog#: ARP38481_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-120850 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Complete computational species homology data Anti-ONECUT1 (ARP38481_P050)
Peptide Sequence Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ONECUT1 (ARP38481_P050) antibody is Catalog # AAP38481 (Previous Catalog # AAPP23190)
Datasheets/Manuals Printable datasheet for anti-ONECUT1 (ARP38481_P050) antibody
Target Reference Jiang,X., (2008) Oncol. Rep. 19 (1), 157-163
Publications

Yuan, X.-W. et al. Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition. J. Biol. Chem. 288, 31206-16 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24022481

Gene Symbol ONECUT1
Official Gene Full Name One cut homeobox 1
Alias Symbols HNF-6, HNF6, HNF6A
NCBI Gene Id 3175
Protein Name Hepatocyte nuclear factor 6
Description of Target ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
Swissprot Id Q9UBC0
Protein Accession # NP_004489
Nucleotide Accession # NM_004498
Protein Size (# AA) 465
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ONECUT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ONECUT1.
Protein Interactions NR0B2; KAT2B; FOXA2; CREBBP; NR3C1; FOXA1;
  1. What is the species homology for "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ONECUT1 Antibody - middle region (ARP38481_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    This target may also be called "HNF-6, HNF6, HNF6A" in publications.

  5. What is the shipping cost for "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ONECUT1 Antibody - middle region (ARP38481_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ONECUT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ONECUT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ONECUT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ONECUT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ONECUT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ONECUT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ONECUT1 Antibody - middle region (ARP38481_P050)
Your Rating
We found other products you might like!