ONECUT1 antibody - middle region (ARP38481_P050)

Catalog#: ARP38481_P050

• Size: 100 ul

• Gene Symbol: ONECUT1
• NCBI Gene Id: 3175
• Official Gene Full Name: One cut homeobox 1
• Protein Name: Hepatocyte nuclear factor 6
• Swissprot Id: Q9UBC0
• Protein Accession #: NP_004489
• Nucleotide Accession #: NM_004498
• Alias Symbols: HNF-6, HNF6, HNF6A
• Replacement Item: This antibody may replace item sc-120850 from Santa Cruz Biotechnology.
• Description of Target: ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
• Protein Size (# AA): 465
• Molecular Weight: 51kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: IHC, WB
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express ONECUT1.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
• Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: NR0B2; KAT2B; FOXA2; CREBBP; NR3C1; FOXA1;
• Blocking Peptide: For anti-ONECUT1 (ARP38481_P050) antibody is Catalog # AAP38481 (Previous Catalog # AAPP23190)
• Target Reference: Jiang,X., (2008) Oncol. Rep. 19 (1), 157-163
• Publications:

  Yuan, X.-W. et al. Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition. J. Biol. Chem. 288, 31206-16 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24022481

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: ONECUT1 antibody tested with Human Jurkat Cells (ARP38481_P050)

Product Protocols: ONECUT1 antibody tested by IHC with human brain, cerebellum (ARP38481)