- Gene Symbol:
- ONECUT1
- NCBI Gene Id:
- 3175
- Official Gene Full Name:
- One cut homeobox 1
- Protein Name:
- Hepatocyte nuclear factor 6
- Swissprot Id:
- Q9UBC0
- Protein Accession #:
- NP_004489
- Nucleotide Accession #:
- NM_004498
- Alias Symbols:
- HNF-6, HNF6, HNF6A
- Replacement Item:
- This antibody may replace item sc-120850 from Santa Cruz Biotechnology.
- Description of Target:
- ONECUT1 belongs to the CUT homeobox family. It contains 1 CUT DNA-binding domain and 1 homeobox DNA-binding domain. It is a transcriptional activator. ONECUT1 binds the consensus sequence 5'-DHWATTGAYTWWD-3' on a variety of gene promoters such as those of HNF3B and TTR. It is important for liver genes transcription.
- Protein Size (# AA):
- 465
- Molecular Weight:
- 51kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express ONECUT1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express ONECUT1.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human ONECUT1
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
- Complete computational species homology data:
- Anti-ONECUT1 (ARP38481_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- NR0B2; KAT2B; FOXA2; CREBBP; NR3C1; FOXA1;
- Blocking Peptide:
- For anti-ONECUT1 (ARP38481_P050) antibody is Catalog # AAP38481 (Previous Catalog # AAPP23190)
- Datasheets/Manuals:
- Printable datasheet for anti-ONECUT1 (ARP38481_P050) antibody
- Target Reference:
- Jiang,X., (2008) Oncol. Rep. 19 (1), 157-163
- Publications:
Yuan, X.-W. et al. Hepatocyte nuclear factor 6 suppresses the migration and invasive growth of lung cancer cells through p53 and the inhibition of epithelial-mesenchymal transition. J. Biol. Chem. 288, 31206-16 (2013). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 24022481
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
