OMPC Recombinant Protein (Escherichia coli) (OPCA02115)

Catalog No: OPCA02115

Forms pores that allow passive diffusion of small molecules across the outer membrane.

ompC Recombinant Protein (Escherichia coli) (OPCA02115) in SDS-PAGE showing the molecular weight of approximately 54.28 kDa.

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Lyophilized 10mM Tris-HCl, 1mM EDTA (pH 8.0)
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length of Mature Protein: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
• Source: E.coli
• Protein Range: 22-367aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Crystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)
• Gene Symbol: ompC
• Gene Full Name: outer membrane porin C
• Alias Symbols: b2215;ECK2207;meoA;outer membrane porin C;Outer membrane protein 1B;par;Porin OmpC.
• NCBI Gene Id: 946716
• Protein Name: Outer membrane protein C
• Description of Target: Forms pores that allow passive diffusion of small molecules across the outer membrane.
• Uniprot ID: P06996
• Protein Accession #: NP_416719.1
  
• Nucleotide Accession #: NC_000913.3
• Protein Size (# AA): Recombinant
• Molecular Weight: 54.3 kDa