Catalog No: OPCA02115
Price: $0.00
SKU
OPCA02115
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

OMPC Recombinant Protein (Escherichia coli) (OPCA02115)

Forms pores that allow passive diffusion of small molecules across the outer membrane.
Datasheets/ManualsPrintable datasheet for ompC Recombinant Protein (Escherichia coli) (OPCA02115)
Product Info
Predicted Species ReactivityEscherichia coli
Product FormatLyophilized PBS, 6% Trehalose (pH 7.4)
Reconstitution and StorageWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
PurificationAffinity purified using IMAC
PurityGreater than 90% as determined by SDS-PAGE.
Protein SequenceFull Length of Mature Protein: AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
SourceE. Coli
Enhanced ValidationEnhanced Validation
TagN-terminal 6xHis-SUMO-tagged
ReferenceCrystal structure of osmoporin OmpC from E. coli at 2.0 A.Basle A., Rummel G., Storici P., Rosenbusch J.P., Schirmer T.J. Mol. Biol. 362:933-942(2006)
Gene SymbolOMPC
Alias SymbolsOuter membrane protein 1BPorin OmpC
NCBI Gene Id946716
Uniprot IDP06996
Protein Accession #NP_416719.1
Nucleotide Accession #NC_000913.3
Protein Size (# AA)22-367 aa
Molecular Weight54 kDa
Write Your Own Review
You're reviewing:OMPC Recombinant Protein (Escherichia coli) (OPCA02115)
Your Rating
We found other products you might like!