OMP Recombinant Protein (Rickettsia japonica) (OPCA04446)

Catalog No: OPCA04446

Product Info

• Predicted Species Reactivity: Rickettsia japonica
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Rickettsia japonica (strain ATCC VR-1363 / YH)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
• Protein Sequence: CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 20-159 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR.Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489(1995)

Target Info

• Gene Symbol: OMP
• Alias Symbols: omp, RJP_094417 kDa surface antigen
• Protein Name: 17 kDa surface antigen
• Uniprot ID: Q52764
• Protein Size (# AA): Recombinant
• Molecular Weight: 30.5 kDa