Catalog No: OPPA02479 (Formerly GWB-E3940D)
Size:100UG
Price: $192.00
SKU
OPPA02479
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPPA02479 |
---|
Predicted Species Reactivity | Helicobacter pylori |
---|---|
Product Format | Liquid 1xPBS (pH 7.4) |
Host | E. Coli |
Application | LF, ELISA |
Reconstitution and Storage | Omp Pylori, although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze/thaw cycles. |
Purification | Purified by proprietary chromatographic techniques. |
Concentration | 1.55 mg/ml |
Purity | Greater than 95% pure as determined by 12% PAGE (Coomassie staining). |
Protein Sequence | MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL. |
Application Info | Can be used for lateral follow product, ELISA assay and vaccine development. |
Gene Symbol | Omp Pylori |
---|---|
Alias Symbols | Omp Pylori |
Description of Target | Helicobacter pylori, a Gram-negative, microaerophilic bacterium that populates in the stomach, predominantly at the antrum. Helicobacter pylori causes a chronic inflammation of the mucoid lining of stomach and is highly related to the growth of duodenal and gastric ulcers and stomach cancer. Over 50% of the world''s population harbor H. pylori in their upper gastrointestinal tract, infection is more prevalent in developing countries. Thus far, no ideal target H. pylori antigen has been developed for the diagnostic purpose. 23 kDa H. pylori outer membrane protein was identified with a good sensitivity and coverage in the diagnosis of H. pylori infection. Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients. |
Protein Size (# AA) | Recombinant |
Molecular Weight | 23 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review