OLIG2 Antibody - N-terminal region : FITC (ARP31464_P050-FITC)

Catalog No: ARP31464_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-OLIG2 (ARP31464_P050-FITC) antibody is Catalog # AAP31464 (Previous Catalog # AAPS08403)
• Reference: Mitkus,S.N., Schizophr. Res. 98 (1-3), 129-138 (2008)

Target Info

• Gene Symbol: OLIG2
• Gene Full Name: Oligodendrocyte lineage transcription factor 2
• Alias Symbols: BHLHB1, OLIGO2, RACK17, PRKCBP2, bHLHe19
• NCBI Gene Id: 10215
• Protein Name: Oligodendrocyte transcription factor 2
• Description of Target: OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q13516
• Protein Accession #: NP_005797
• Nucleotide Accession #: NM_005806
• Protein Size (# AA): 323
• Molecular Weight: 32kDa
• Protein Interactions: CUL3; SRRM1; SOX8; NKX2-2; EP300; SOX10;