Search Antibody, Protein, and ELISA Kit Solutions

OLIG2 Antibody - N-terminal region (ARP31464_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31464_P050-FITC Conjugated

ARP31464_P050-HRP Conjugated

ARP31464_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Oligodendrocyte lineage transcription factor 2
NCBI Gene Id:
Protein Name:
Oligodendrocyte transcription factor 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-133869 from Santa Cruz Biotechnology.
Description of Target:
OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OLIG2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OLIG2.
The immunogen is a synthetic peptide directed towards the N terminal region of human OLIG2
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-OLIG2 (ARP31464_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CUL3; SRRM1; SOX8; NKX2-2; EP300; SOX10;
Blocking Peptide:
For anti-OLIG2 (ARP31464_P050) antibody is Catalog # AAP31464 (Previous Catalog # AAPS08403)
Printable datasheet for anti-OLIG2 (ARP31464_P050) antibody
Target Reference:
Mitkus,S.N., Schizophr. Res. 98 (1-3), 129-138 (2008)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...