Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP96679_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

OLFR490 Antibody - C-terminal region (ARP96679_P050)

Catalog#: ARP96679_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityMouse
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR490
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: PKSSYSMDQNKIISVFYMVVVPMLNPLIYSLRNNEIKGALKRHFDRKTFS
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-OLFR490 (ARP96679_P050) antibody is Catalog # ARP96679_P050
Datasheets/ManualsPrintable datasheet for anti-OLFR490 (ARP96679_P050) antibody
Gene SymbolOLFR490
Official Gene Full Nameolfactory receptor 490
Alias SymbolsMOR204-17
NCBI Gene Id258491
Protein NameOlfactory receptor 490
Description of TargetOlfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Swissprot IdQ8VFD2
Protein Accession #NP_666709.1
Nucleotide Accession #NM_146498.1
Protein Size (# AA)314
Molecular Weight35 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express OLFR490.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express OLFR490.
Write Your Own Review
You're reviewing:OLFR490 Antibody - C-terminal region (ARP96679_P050)
Your Rating
Aviva Travel Grant
Aviva Tissue Tool
Aviva ChIP Antibodies
Aviva Validation Data