Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

OLFR470 Antibody - C-terminal region (ARP96624_P050)

Catalog#: ARP96624_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Mouse
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR470
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: MPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNNEIKGALKRQLARKIF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-OLFR470 (ARP96624_P050) antibody is Catalog # ARP96624_P050
Datasheets/Manuals Printable datasheet for anti-OLFR470 (ARP96624_P050) antibody
Gene Symbol OLFR470
Official Gene Full Name olfactory receptor 470
Alias Symbols MOR204-22
NCBI Gene Id 258417
Protein Name Olfactory receptor 469
Description of Target Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Swissprot Id Q8VF66
Protein Accession # NP_666636.1
Nucleotide Accession # NM_146425.1
Protein Size (# AA) 314
Molecular Weight 35 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OLFR470.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OLFR470.
  1. What is the species homology for "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "OLFR470 Antibody - C-terminal region (ARP96624_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    This target may also be called "MOR204-22" in publications.

  5. What is the shipping cost for "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OLFR470 Antibody - C-terminal region (ARP96624_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "OLFR470"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OLFR470"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OLFR470"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OLFR470"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OLFR470"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OLFR470"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OLFR470 Antibody - C-terminal region (ARP96624_P050)
Your Rating