Catalog No: ARP56264_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-OLAH (ARP56264_P050) antibody
Product Info
ReferenceNakamura,N., (2006) DNA Res. 13 (4), 169-183
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human OLAH
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 77%; Human: 100%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
Concentration0.5 mg/ml
Blocking PeptideFor anti-OLAH (ARP56264_P050) antibody is Catalog # AAP56264 (Previous Catalog # AAPP38231)
Sample Type Confirmation

OLAH is supported by BioGPS gene expression data to be expressed in HT1080

Gene SymbolOLAH
Gene Full NameOleoyl-ACP hydrolase
Alias SymbolsTE2, SAST, AURA1, THEDC1
NCBI Gene Id55301
Protein NameS-acyl fatty acid synthase thioesterase, medium chain
Description of TargetOLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f
Uniprot IDQ9NV23
Protein Accession #NP_001034791
Nucleotide Accession #NM_001039702
Protein Size (# AA)265
Molecular Weight30kDa
  1. What is the species homology for "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Guinea Pig".

  2. How long will it take to receive "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OLAH Antibody - N-terminal region (ARP56264_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    This target may also be called "TE2, SAST, AURA1, THEDC1" in publications.

  5. What is the shipping cost for "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OLAH Antibody - N-terminal region (ARP56264_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "OLAH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OLAH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OLAH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OLAH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OLAH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OLAH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OLAH Antibody - N-terminal region (ARP56264_P050)
Your Rating
We found other products you might like!