Catalog No: ARP53126_P050
Price: $0.00
SKU
ARP53126_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

ODF4 Antibody - N-terminal region (ARP53126_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-ODF4 (ARP53126_P050) antibody
Product Info
ReferenceMiyamoto,T., (2004) J. Assist. Reprod. Genet. 21 (4), 129-134
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human ODF4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL
Concentration0.5 mg/ml
Blocking PeptideFor anti-ODF4 (ARP53126_P050) antibody is Catalog # AAP53126 (Previous Catalog # AAPP35608)
Gene SymbolODF4
Gene Full NameOuter dense fiber of sperm tails 4
Alias SymbolsCT134, CT136, OPPO1
NCBI Gene Id146852
Protein NameOuter dense fiber protein 4
Description of TargetODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton. This gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Sequence Note: The RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.
Uniprot IDQ2M2E3
Protein Accession #NP_694552
Nucleotide Accession #NM_153007
Protein Size (# AA)257
Molecular Weight29kDa
Protein InteractionsAPP;
  1. What is the species homology for "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "ODF4 Antibody - N-terminal region (ARP53126_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    This target may also be called "CT134, CT136, OPPO1" in publications.

  5. What is the shipping cost for "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "ODF4 Antibody - N-terminal region (ARP53126_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ODF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ODF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ODF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ODF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ODF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ODF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:ODF4 Antibody - N-terminal region (ARP53126_P050)
Your Rating
We found other products you might like!