OCIAD2 Antibody - middle region (ARP52941_P050)

Catalog No: ARP52941_P050

WB Suggested Anti-OCIAD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OCIAD2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-OCIAD2 (ARP52941_P050) antibody is Catalog # AAP52941 (Previous Catalog # AAPP34926)

Target Info

• Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954
• Gene Symbol: OCIAD2
• Gene Full Name: OCIA domain containing 2
• Alias Symbols: DKFZp686C03164, MGC45416
• NCBI Gene Id: 132299
• Protein Name: OCIA domain-containing protein 2
• Description of Target: The exact function of OCIAD2 is not known.
• Uniprot ID: Q56VL3
• Protein Accession #: NP_001014446
• Nucleotide Accession #: NM_001014446
• Protein Size (# AA): 154
• Molecular Weight: 17kDa
• Protein Interactions: RNF2; UBC; MMGT1; ILF3; APP;