OASL2 Antibody - middle region (ARP91798_P050)

Catalog No: ARP91798_P050

Host: Rabbit
Target Name: OASL2
Sample Tissue: Rat Brain lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of rat OASL2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-OASL2 (ARP91798_P050) antibody is Catalog # AAP91798

Target Info

• Gene Symbol: OASL2
• Gene Full Name: 2'-5' oligoadenylate synthetase-like 2
• Alias Symbols: Mmu-, Oasl, M1204, Mmu-OASL
• NCBI Gene Id: 23962
• Protein Name: 2'-5'-oligoadenylate synthase-like protein 2
• Description of Target: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Synthesizes oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L (By similarity).
• Uniprot ID: Q5MYT9
• Protein Accession #: NP_035984.2
• Nucleotide Accession #: NM_011854.2
• Protein Size (# AA): 511
• Molecular Weight: 59 kDa