OAS1 Antibody - middle region : HRP (ARP51359_P050-HRP)

Catalog No: ARP51359_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAS1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-OAS1 (ARP51359_P050-HRP) antibody is Catalog # AAP51359 (Previous Catalog # AAPS23611)
• Reference: Phosri,C., Mycol. Res. 111 (PT 3), 275-286 (2007)
• Publications:

  Zhu, W. et al. RIG-I-like receptors mediate innate antiviral response in mouse testis. Mol. Endocrinol. 27, 1455-67 (2013). WB, IHC, IP, Human, Horse, Rat, Bovine, Dog, Pig, Mouse, Guinea pig, Rabbit 23820901

  Yu, L. et al. Pattern recognition receptor-initiated innate antiviral response in mouse adipose cells. Immunol. Cell Biol. 92, 105-15 (2014). WB, IHC, IP, Human, Horse, Rat, Bovine, Dog, Pig, Mouse, Guinea pig, Rabbit 24165978

Target Info

• Gene Symbol: OAS1
• Gene Full Name: 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• Alias Symbols: OIAS, IFI-4, OIASI, E18/E16
• NCBI Gene Id: 4938
• Protein Name: 2'-5'-oligoadenylate synthase 1
• Description of Target: This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.
• Uniprot ID: P00973-3
• Protein Accession #: NP_001027581
• Nucleotide Accession #: NM_001032409
• Protein Size (# AA): 414
• Molecular Weight: 47kDa
• Protein Interactions: EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;