Search Antibody, Protein, and ELISA Kit Solutions

OAS1 Antibody - middle region (ARP51359_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51359_P050-FITC Conjugated

ARP51359_P050-HRP Conjugated

ARP51359_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
2'-5'-oligoadenylate synthetase 1, 40/46kDa
NCBI Gene Id:
Protein Name:
2'-5'-oligoadenylate synthase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-100639 from Santa Cruz Biotechnology.
Description of Target:
This protein is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OAS1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
The immunogen is a synthetic peptide directed towards the middle region of human OAS1
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 87%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-OAS1 (ARP51359_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-OAS1 (ARP51359_P050) antibody is Catalog # AAP51359 (Previous Catalog # AAPS23611)
Printable datasheet for anti-OAS1 (ARP51359_P050) antibody
Application Info:
IHC - Paraffin ~~ 5 ug/ml
Western blot ~~1 ug/ml
Target Reference:
Phosri,C., Mycol. Res. 111 (PT 3), 275-286 (2007)

Yu, L. et al. Pattern recognition receptor-initiated innate antiviral response in mouse adipose cells. Immunol. Cell Biol. 92, 105-15 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24165978

Zhu, W. et al. RIG-I-like receptors mediate innate antiviral response in mouse testis. Mol. Endocrinol. 27, 1455-67 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 23820901

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...