OAS1 Antibody - C-terminal region (ARP30587_P050)

Catalog#: ARP30587_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-100639 from Santa Cruz Biotechnology.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
• Sample Type Confirmation:

  OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

• Publications:

  Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). IHC, WB, Human 21199806

• Gene Symbol: OAS1
• Official Gene Full Name: 2'-5'-oligoadenylate synthetase 1, 40/46kDa
• Alias Symbols: IFI-4, OIAS, OIASI
• NCBI Gene Id: 4938
• Protein Name: 2'-5'-oligoadenylate synthase 1
• Description of Target: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
• Swissprot Id: P00973
• Protein Accession #: NP_058132
• Nucleotide Accession #: NM_016816
• Protein Size (# AA): 400
• Molecular Weight: 46kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
• Protein Interactions: EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.