- Gene Symbol:
- OAS1
- NCBI Gene Id:
- 4938
- Official Gene Full Name:
- 2'-5'-oligoadenylate synthetase 1, 40/46kDa
- Protein Name:
- 2'-5'-oligoadenylate synthase 1
- Swissprot Id:
- P00973
- Protein Accession #:
- NP_058132
- Nucleotide Accession #:
- NM_016816
- Alias Symbols:
- IFI-4, OIAS, OIASI
- Replacement Item:
- This antibody may replace item sc-100639 from Santa Cruz Biotechnology.
- Description of Target:
- OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
- Protein Size (# AA):
- 400
- Molecular Weight:
- 46kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express OAS1.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Complete computational species homology data:
- Anti-OAS1 (ARP30587_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
- Blocking Peptide:
- For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
- Datasheets/Manuals:
- Printable datasheet for anti-OAS1 (ARP30587_P050) antibody
- Sample Type Confirmation:
OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7
- Publications:
Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). IHC, WB, Human 21199806
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
