Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP30587_P050-FITC Conjugated

ARP30587_P050-HRP Conjugated

ARP30587_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-100639 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-OAS1 (ARP30587_P050)
Peptide Sequence Synthetic peptide located within the following region: EAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEY
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-OAS1 (ARP30587_P050) antibody is Catalog # AAP30587
Datasheets/Manuals Printable datasheet for anti-OAS1 (ARP30587_P050) antibody
Sample Type Confirmation

OAS1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, MCF7


Li, Q. & Tainsky, M. A. Higher miRNA tolerance in immortal Li-Fraumeni fibroblasts with abrogated interferon signaling pathway. Cancer Res. 71, 255-65 (2011). IHC, WB, Human 21199806

Gene Symbol OAS1
Official Gene Full Name 2'-5'-oligoadenylate synthetase 1, 40/46kDa
Alias Symbols IFI-4, OIAS, OIASI
NCBI Gene Id 4938
Protein Name 2'-5'-oligoadenylate synthase 1
Description of Target OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.
Swissprot Id P00973
Protein Accession # NP_058132
Nucleotide Accession # NM_016816
Protein Size (# AA) 400
Molecular Weight 46kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express OAS1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express OAS1.
Protein Interactions EXOC5; TRIM27; ACTN1; PRMT6; WBSCR22; RPL30; HCVgp1;
  1. What is the species homology for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "OAS1 Antibody - C-terminal region (ARP30587_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    This target may also be called "IFI-4, OIAS, OIASI" in publications.

  5. What is the shipping cost for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "OAS1 Antibody - C-terminal region (ARP30587_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "OAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "OAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "OAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "OAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "OAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "OAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:OAS1 Antibody - C-terminal region (ARP30587_P050)
Your Rating
We found other products you might like!