- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for NVL Antibody (OAAL00224) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 3F6 |
Isotype | IgG1 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | NVL (NP_002524, 757 a.a. ~ 856 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | ILKTITKNGTKPPLDADVNLEAIAGDLRCDCYTGADLSALVREASICALRQEMARQKSGNEKGELKVSHKHFEEAFKKVRSSISKKDQIMYERLQESLSR |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | NVL |
---|---|
Gene Full Name | nuclear VCP like |
Alias Symbols | nuclear valosin-containing protein-like;NVL2;NVLp. |
NCBI Gene Id | 4931 |
Protein Name | Homo sapiens nuclear VCP-like (NVL), transcript variant 1, mRNA|nuclear valosin-containing protein-like isoform 1 [Homo sapiens] |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_002524 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_002533 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NVL Antibody (OAAL00224)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "NVL Antibody (OAAL00224)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "NVL Antibody (OAAL00224)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NVL Antibody (OAAL00224)"?
This target may also be called "nuclear valosin-containing protein-like;NVL2;NVLp." in publications.
-
What is the shipping cost for "NVL Antibody (OAAL00224)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NVL Antibody (OAAL00224)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NVL Antibody (OAAL00224)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NVL Antibody (OAAL00224)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NVL"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NVL"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NVL"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NVL"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NVL"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NVL"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.