Catalog No: OABB01785
Size:100UG
Price: $432.00
SKU
OABB01785
Availability: Domestic: within 1-2 week delivery | International: within 1-2 week delivery
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for NUP98 Antibody (OABB01785)
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman|Mouse|Rat
Product FormatLyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
ClonalityPolyclonal
ClonePolyclonal
IsotypeRabbit IgG
HostRabbit
ApplicationWB
Additional InformationNotes: WB: The detection limit for NUP98 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
::Background: Nuclear pore complex protein Nup98-Nup96 is a protein that in humans is encoded by the NUP98 gene. This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. NUP98 is a peripheral nucleoporin located at both the cytoplasmic and nuclear sides of the central channel of the NPC. NUP98 phosphorylation is critical for NPC disassembly at the onset of mitosis. It also plays roles in gene expression, mitotic checkpoint, and pathogenesis. Ligand blot analysis suggested that NUP98 can function as a docking protein for cytosol-mediated docking of import substrates. In addition to that, NUP98 is a target of the vesicular stomatitis virus M protein-mediated inhibition of mRNA nuclear export.
Reconstitution and Storage2°C to 8°C|-20°C
ImmunogenE.coli-derived human NUP98 recombinant protein (Position: H549-F880). Human NUP98 shares 95% and 94% amino acid (aa) sequence identity with mouse and rat NUP98, respectively.
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: HYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF
Concentration500 ug/ml
Target Post-Translational ModificationBelongs to the nucleoporin GLFG family.
SpecificityNo cross reactivity with other proteins.
Application InfoWestern blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
Storage BufferEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reference1. Laurell, E., Beck, K., Krupina, K., Theerthagiri, G., Bodenmiller, B., Horvath, P., Aebersold, R., Antonin, W., Kutay, U. Phosphorylation of Nup98 by multiple kinases is crucial for NPC disassembly during mitotic entry. Cell 144: 539-550, 2011.
2. Nakamura, T., Largaespada, D. A., Lee, M. P., Johnson, L. A., Ohyashiki, K., Toyama, K., Chen, S. J., Willman, C. L., Chen, I.-M., Feinberg, A. P., Jenkins, N. A., Copeland, N. G., Shaughnessy, J. D., Jr. Fusion of the nucleoporin gene NUP98 to HOXA9 by the chromosome translocation t(7;11)(p15;p15) in human myeloid leukaemia. Nature Genet. 12: 154-158, 1996.
3. von Kobbe, C., van Deursen, J. M. A., Rodrigues, J. P., Sitterlin, D., Bachi, A., Wu, X., Wilm, M., Carmo-Fonseca, M., Izaurralde, E. Vesicular stomatitis virus matrix protein inhibits host cell gene expression by targeting the nucleoporin Nup98. Molec. Cell 6: 1243-1252, 2000.
Gene SymbolNUP98
Gene Full Namenucleoporin 98 and 96 precursor
Alias SymbolsADIR2;GLFG-repeat containing nucleoporin;nuclear pore complex protein Nup98;nuclear pore complex protein Nup98-Nup96;nucleoporin 96;nucleoporin 98kD;nucleoporin 98kDa;NUP196;NUP96;NUP98/PHF23 fusion 2 protein;Nup98-96;Nup98-Nup96.
NCBI Gene Id4928
Protein NameNuclear pore complex protein Nup98-Nup96
Description of TargetPlays a role in the nuclear pore complex (NPC) assembly and/or maintenance. NUP98 and NUP96 are involved in the bidirectional transport across the NPC. May anchor NUP153 and TPR to the NPC. In cooperation with DHX9, plays a role in transcription and alternative splicing activation of a subset of genes (PubMed:28221134). Involved in the localization of DHX9 in discrete intranuclear foci (GLFG-body) (PubMed:28221134).
Uniprot IDP52948
Molecular Weight197579 MW
  1. What is the species homology for "NUP98 Antibody (OABB01785)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "NUP98 Antibody (OABB01785)"?

    This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".

  3. What buffer format is "NUP98 Antibody (OABB01785)" provided in?

    This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NUP98 Antibody (OABB01785)"?

    This target may also be called "ADIR2;GLFG-repeat containing nucleoporin;nuclear pore complex protein Nup98;nuclear pore complex protein Nup98-Nup96;nucleoporin 96;nucleoporin 98kD;nucleoporin 98kDa;NUP196;NUP96;NUP98/PHF23 fusion 2 protein;Nup98-96;Nup98-Nup96." in publications.

  5. What is the shipping cost for "NUP98 Antibody (OABB01785)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NUP98 Antibody (OABB01785)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NUP98 Antibody (OABB01785)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "197579 MW".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NUP98 Antibody (OABB01785)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NUP98"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NUP98"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NUP98"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NUP98"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NUP98"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NUP98"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NUP98 Antibody (OABB01785)
Your Rating
We found other products you might like!