NUP98 Antibody (OABB01785)

Catalog No: OABB01785

Size:100UG

Anti-NUP98 Picoband antibody, OABB01785, Western blotting
All lanes: Anti NUP98 (OABB01785) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: Mouse Lung Tissue Lysate at 50ug
Lane 4: A549 Whole Cell Lysate at 40ug
Lane 5: SMMC Whole Cell Lysate at 40ug
Predicted bind size: 98KD
Observed bind size: 98KD

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Western blot
• Additional Information: Notes: WB: The detection limit for NUP98 is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
  Background: Nuclear pore complex protein Nup98-Nup96 is a protein that in humans is encoded by the NUP98 gene. This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. NUP98 is a peripheral nucleoporin located at both the cytoplasmic and nuclear sides of the central channel of the NPC. NUP98 phosphorylation is critical for NPC disassembly at the onset of mitosis. It also plays roles in gene expression, mitotic checkpoint, and pathogenesis. Ligand blot analysis suggested that NUP98 can function as a docking protein for cytosol-mediated docking of import substrates. In addition to that, NUP98 is a target of the vesicular stomatitis virus M protein-mediated inhibition of mRNA nuclear export.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E.coli-derived human NUP98 recombinant protein (Position: H549-F880). Human NUP98 shares 95% and 94% amino acid (aa) sequence identity with mouse and rat NUP98, respectively.
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: HYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKLVLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYTNPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHF
• Concentration: 500 ug/ml
• Target Post-Translational Modification: Belongs to the nucleoporin GLFG family.
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
• Reference: 1. Laurell, E., Beck, K., Krupina, K., Theerthagiri, G., Bodenmiller, B., Horvath, P., Aebersold, R., Antonin, W., Kutay, U. Phosphorylation of Nup98 by multiple kinases is crucial for NPC disassembly during mitotic entry. Cell 144: 539-550, 2011.
  2. Nakamura, T., Largaespada, D. A., Lee, M. P., Johnson, L. A., Ohyashiki, K., Toyama, K., Chen, S. J., Willman, C. L., Chen, I.-M., Feinberg, A. P., Jenkins, N. A., Copeland, N. G., Shaughnessy, J. D., Jr. Fusion of the nucleoporin gene NUP98 to HOXA9 by the chromosome translocation t(7;11)(p15;p15) in human myeloid leukaemia. Nature Genet. 12: 154-158, 1996.
  3. von Kobbe, C., van Deursen, J. M. A., Rodrigues, J. P., Sitterlin, D., Bachi, A., Wu, X., Wilm, M., Carmo-Fonseca, M., Izaurralde, E. Vesicular stomatitis virus matrix protein inhibits host cell gene expression by targeting the nucleoporin Nup98. Molec. Cell 6: 1243-1252, 2000.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Nuclear pore complex protein Nup98-Nup96(NUP98) detection. Tested with WB in Human;Mouse;Rat.

Target Info

• Gene Symbol: NUP98
• Gene Full Name: nucleoporin 98 and 96 precursor
• Alias Symbols: ADIR2;GLFG-repeat containing nucleoporin;nuclear pore complex protein Nup98;nuclear pore complex protein Nup98-Nup96;nucleoporin 96;nucleoporin 98kD;nucleoporin 98kDa;NUP196;NUP96;NUP98/PHF23 fusion 2 protein;Nup98-96;Nup98-Nup96.
• NCBI Gene Id: 4928
• Protein Name: Nuclear pore complex protein Nup98-Nup96
• Description of Target: Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance. NUP98 and NUP96 are involved in the bidirectional transport across the NPC. May anchor NUP153 and TPR to the NPC. In cooperation with DHX9, plays a role in transcription and alternative splicing activation of a subset of genes (PubMed:28221134). Involved in the localization of DHX9 in discrete intranuclear foci (GLFG-body) (PubMed:28221134).
• Uniprot ID: P52948
• Molecular Weight: 197579 MW