Search Antibody, Protein, and ELISA Kit Solutions

NUP88 Antibody - middle region : FITC (ARP72695_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72695_P050 Unconjugated

ARP72695_P050-HRP Conjugated

ARP72695_P050-Biotin Conjugated

Gene Symbol:
NUP88
NCBI Gene Id:
4927
Swissprot Id:
Q99567
Protein Accession #:
NP_002523
Alias Symbols:
NUP88,
Replacement Item:
This antibody may replace item sc-136009 from Santa Cruz Biotechnology.
Description of Target:
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN/Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias.
Protein Size (# AA):
741
Molecular Weight:
81kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUP88.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUP88.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human NUP88
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLIPSLYVFE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; SUMO2; SUMO1; SUZ12; RNF2; ARFGEF2; FLNC; RBM42; CPSF6; CIRBP; NXF1; CAND1; CUL2; CUL3; SIRT7; Nup98; Nup214; Nup188; Obfc1; Nup88; SET; tat; RAE1; CD82;
Blocking Peptide:
For anti-NUP88 (ARP72695_P050-FITC) antibody is Catalog # AAP72695
Datasheets/Manuals:
Printable datasheet for anti-NUP88 (ARP72695_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...