Search Antibody, Protein, and ELISA Kit Solutions

NUP88 Antibody - middle region (ARP88227_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NUP88
Official Gene Full Name:
nucleoporin 88
NCBI Gene Id:
4927
Protein Name:
Nuclear pore complex protein Nup88
Swissprot Id:
Q99567
Protein Accession #:
NP_001307582.1
Nucleotide Accession #:
NM_001320653.1
Description of Target:
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN/Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
741
Molecular Weight:
81 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUP88.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUP88.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NUP88
Peptide Sequence:
Synthetic peptide located within the following region: NYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDS
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NUP88 (ARP88227_P050) antibody is Catalog # AAP88227
Datasheets/Manuals:
Printable datasheet for anti-NUP88 (ARP88227_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...