Search Antibody, Protein, and ELISA Kit Solutions

NUP88 Antibody - middle region (ARP88227_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
nucleoporin 88
NCBI Gene Id:
Protein Name:
Nuclear pore complex protein Nup88
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Description of Target:
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN/Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein Size (# AA):
Molecular Weight:
81 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUP88.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUP88.
The immunogen is a synthetic peptide directed towards the middle region of human NUP88
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: NYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NUP88 (ARP88227_P050) antibody is Catalog # AAP88227
Printable datasheet for anti-NUP88 (ARP88227_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...