NUP50 Antibody - C-terminal region (ARP52288_P050)

Catalog No: ARP52288_P050

WB Suggested Anti-NUP50 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that NUP50 is expressed in HepG2

Host: Rabbit
Target Name: NUP50
Sample Type: HepG2
Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that NUP50 is expressed in HepG2

Host: Rabbit
Target Name: NUP50
Sample Type: Hela
Antibody Dilution: 1.0ug/mlNUP50 is supported by BioGPS gene expression data to be expressed in HeLa

Sample Type : Hela cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IF, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUP50
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 92%; Yeast: 80%
• Peptide Sequence: Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NUP50 (ARP52288_P050) antibody is Catalog # AAP52288 (Previous Catalog # AAPS30802)
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that NUP50 is expressed in HepG2

  NUP50 is supported by BioGPS gene expression data to be expressed in HeLa

Target Info

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648
• Gene Symbol: NUP50
• Gene Full Name: Nucleoporin 50kDa
• Alias Symbols: NPAP60, NPAP60L
• NCBI Gene Id: 10762
• Protein Name: Nuclear pore complex protein Nup50
• Description of Target: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9UKX7
• Protein Accession #: NP_009103
• Nucleotide Accession #: NM_007172
• Protein Size (# AA): 468
• Molecular Weight: 50kDa
• Protein Interactions: KPNA5; KPNA4; KPNA3; KPNA2; KPNA1; KPNA6; UBC; KIAA1033; SART3; TTI1; TSC22D1; IKBKAP; KIF5B; EPB41L1; ACACA; SRPK2; LMNA; HDAC6; NPM1; UBAP2; TOR1AIP1; NUP153; APP; CUL3; Mki67; Kifc5b; SLX4; KPNB1; XPO1; RAN; CDKN1B; IPO13;