Catalog No: ARP52288_P050
Price: $0.00
SKU
ARP52288_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NUP50 (ARP52288_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NUP50
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 100%; Rabbit: 100%; Rat: 92%; Yeast: 80%
Peptide SequenceSynthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED
Concentration0.5 mg/ml
Blocking PeptideFor anti-NUP50 (ARP52288_P050) antibody is Catalog # AAP52288 (Previous Catalog # AAPS30802)
Sample Type Confirmation

There is BioGPS gene expression data showing that NUP50 is expressed in HepG2

NUP50 is supported by BioGPS gene expression data to be expressed in HeLa

ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolNUP50
Gene Full NameNucleoporin 50kDa
Alias SymbolsNPAP60, NPAP60L
NCBI Gene Id10762
Protein NameNuclear pore complex protein Nup50
Description of TargetThe nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9UKX7
Protein Accession #NP_009103
Nucleotide Accession #NM_007172
Protein Size (# AA)468
Molecular Weight50kDa
Protein InteractionsKPNA5; KPNA4; KPNA3; KPNA2; KPNA1; KPNA6; UBC; KIAA1033; SART3; TTI1; TSC22D1; IKBKAP; KIF5B; EPB41L1; ACACA; SRPK2; LMNA; HDAC6; NPM1; UBAP2; TOR1AIP1; NUP153; APP; CUL3; Mki67; Kifc5b; SLX4; KPNB1; XPO1; RAN; CDKN1B; IPO13;
  1. What is the species homology for "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast".

  2. How long will it take to receive "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NUP50 Antibody - C-terminal region (ARP52288_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    This target may also be called "NPAP60, NPAP60L" in publications.

  5. What is the shipping cost for "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "50kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NUP50 Antibody - C-terminal region (ARP52288_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NUP50"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NUP50"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NUP50"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NUP50"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NUP50"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NUP50"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NUP50 Antibody - C-terminal region (ARP52288_P050)
Your Rating