NUP43 Antibody - middle region (ARP55922_P050)

Catalog No: ARP55922_P050

WB Suggested Anti-NUP43 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus

NUP43 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP55922_P050 with 1:200 dilution. Western blot was performed using ARP55922_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: NUP43 IP with ARP55922_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP43
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NUP43 (ARP55922_P050) antibody is Catalog # AAP55922 (Previous Catalog # AAPP37212)

Target Info

• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Gene Symbol: NUP43
• Gene Full Name: Nucleoporin 43kDa
• Alias Symbols: p42, bA350J20.1
• NCBI Gene Id: 348995
• Protein Name: Nucleoporin Nup43
• Description of Target: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BG567254.1 2-11 11-24 CB989591.1 28-41 25-47 AK074311.1 1-23 48-1751 AF514997.1 1-1704 1752-2581 BC047539.1 2681-3510 2582-2745 BC046637.1 2350-2513 2746-2818 BG527619.1 33-105 c 2819-3862 BC046637.1 2587-3630
• Uniprot ID: Q8NFH3
• Protein Accession #: NP_942590
• Nucleotide Accession #: NM_198887
• Protein Size (# AA): 380
• Molecular Weight: 42kDa
• Protein Interactions: UBC; SUMO1; SEH1L; DCTN2; TP53RK; RAB3GAP2; NUP107; UBD; ISG15; CUL4A; DDB1; Nup98; NUP37; NUP85; NUP133; NUP160;