Nup37 Antibody - N-terminal region (ARP46327_P050)

Catalog No: ARP46327_P050

WB Suggested Anti-Nup37 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EEETDIEGIQYKTLRTFHHGVRVDGIAWSPETKLDSLPPVIKFCTSAADL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Nup37 (ARP46327_P050) antibody is Catalog # AAP46327 (Previous Catalog # AAPS18012)

Target Info

• Gene Symbol: Nup37
• Gene Full Name: Nucleoporin 37
• Alias Symbols: 2410003L22Rik, 2810039M17Rik
• NCBI Gene Id: 69736
• Protein Name: Nucleoporin Nup37
• Description of Target: Nup37 is a component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.
• Uniprot ID: Q9CWU9
• Protein Accession #: NP_081467
• Nucleotide Accession #: NM_027191
• Protein Size (# AA): 326
• Molecular Weight: 37kDa
• Protein Interactions: TGFBR1;