NUP133 Antibody - middle region (ARP75678_P050)

Catalog No: ARP75678_P050

Host: Rabbit
Target Name: NUP133
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 3ug/ml

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP133
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: QVLRDAPMDSIEWAEVVINVNNILKDMLQAASHYRQNRNSLYRREESLEK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NUP133 (ARP75678_P050) antibody is Catalog # AAP75678

Target Info

• Gene Symbol: NUP133
• Gene Full Name: nucleoporin 133
• Alias Symbols: GAMOS8, NPHS18, hNUP133
• NCBI Gene Id: 55746
• Protein Name: Nuclear pore complex protein Nup133
• Description of Target: The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.
• Uniprot ID: Q8WUM0
• Protein Accession #: NP_060700.2
• Nucleotide Accession #: NM_018230.3
• Protein Size (# AA): 1156
• Molecular Weight: 127 kDa