Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP83971_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

NUMB Antibody - C-terminal region (ARP83971_P050)

Catalog#: ARP83971_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NUMB
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-NUMB (ARP83971_P050) antibody is Catalog # AAP83971
Datasheets/ManualsPrintable datasheet for anti-NUMB (ARP83971_P050) antibody
Gene SymbolNUMB
Official Gene Full Namenumb homolog (Drosophila)
Alias SymbolsS171, C14orf41, c14_5527
NCBI Gene Id8650
Protein Nameprotein numb homolog
Description of TargetThe protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
Swissprot IdP49757-7
Protein Accession #NP_001005743.1
Nucleotide Accession #NM_001005743.1
Protein Size (# AA)456
Molecular Weight50 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express NUMB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express NUMB.
Write Your Own Review
You're reviewing:NUMB Antibody - C-terminal region (ARP83971_P050)
Your Rating
Free Microscope
Aviva ChIP Antibodies
Aviva HIS tag Deal
Aviva Blast Tool