Search Antibody, Protein, and ELISA Kit Solutions

NUMB Antibody - C-terminal region (ARP83971_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
NUMB
Official Gene Full Name:
numb homolog (Drosophila)
NCBI Gene Id:
8650
Protein Name:
protein numb homolog
Swissprot Id:
P49757-7
Protein Accession #:
NP_001005743.1
Nucleotide Accession #:
NM_001005743.1
Alias Symbols:
S171, C14orf41, c14_5527
Description of Target:
The protein encoded by this gene plays a role in the determination of cell fates during development. The encoded protein, whose degradation is induced in a proteasome-dependent manner by MDM2, is a membrane-bound protein that has been shown to associate with EPS15, LNX1, and NOTCH1. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
456
Molecular Weight:
50 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUMB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUMB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NUMB
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NUMB (ARP83971_P050) antibody is Catalog # AAP83971
Datasheets/Manuals:
Printable datasheet for anti-NUMB (ARP83971_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...