Numb Antibody - C-terminal region (ARP59433_P050)

Catalog No: ARP59433_P050

Numb antibody - C-terminal region (ARP59433_P050) validated by WB using Mouse Brain lysate at 1.0ug/ml.

Sample Type: 3. rat brain extract (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science 

Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application: IHC
Species+tissue/cell type: Human brain stem cells
Primary antibody dilution: 1:500
Secondary antibody: Goat anti-rabbit Alexa-Fluor 594
Secondary antibody dilution: 1:1000

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: ASGNRHAEVPPGTCPVDPFEAQWAALESKSKQRTNPSPTNPFSSDLQKTF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Numb (ARP59433_P050) antibody is Catalog # AAP59433

Target Info

• Gene Symbol: Numb
• Gene Full Name: Numb gene homolog (Drosophila)
• Alias Symbols: Nb, m-num
• NCBI Gene Id: 18222
• Protein Name: Protein numb homolog
• Description of Target: Numb plays a role in the process of neurogenesis. It is required throughout embryonic neurogenesis to maintain neural progenitor cells, also called radial glial cells (RGCs), by allowing their daughter cells to choose progenitor over neuronal cell fate. It is not required for the proliferation of neural progenitor cells before the onset of neurogenesis. It is also involved postnatally in the subventricular zone (SVZ) neurogenesis by regulating SVZ neuroblasts survival and ependymal wall integrity. It may also mediate local repair of brain ventricular wall damage.
• Uniprot ID: Q9QZS3-2
• Protein Accession #: NP_035079
• Nucleotide Accession #: NM_010949
• Protein Size (# AA): 604
• Molecular Weight: 66kDa
• Protein Interactions: Igsf5; Eed; Grin1; Cdh2; Cdh1; Ctnnb1; Ctnna1; Lnx2; Lnx1; Notch1; Eps15; Ehd1; Ehd4;