Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

NUDT9 Antibody - C-terminal region : FITC (ARP35541_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35541_P050 Unconjugated

ARP35541_P050-HRP Conjugated

ARP35541_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
NUDT9, NUDT10, PSEC0099, UNQ3012/PRO9771,
Replacement Item:
This antibody may replace item sc-133857 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene belongs to the Nudix hydrolase family. Nudix boxes are found in a family of diverse enzymes that catalyze the hydrolysis of nucleoside diphosphate derivatives. This enzyme is an ADP-ribose pyrophosphatase that catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P. It requires divalent metal ions and an intact Nudix motif for enzymatic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUDT9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUDT9.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NUDT9
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: GGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHLV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NUDT9 (ARP35541_P050-FITC) antibody is Catalog # AAP35541
Printable datasheet for anti-NUDT9 (ARP35541_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...