Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP62697_P050 Unconjugated

ARP62697_P050-FITC Conjugated

ARP62697_P050-HRP Conjugated

NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)

Catalog#: ARP62697_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation Biotin
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-173542 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Complete computational species homology data Anti-NUDT2 (ARP62697_P050)
Peptide Sequence Synthetic peptide located within the following region: ETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYD
Concentration 0.5 mg/ml
Blocking Peptide For anti-NUDT2 (ARP62697_P050-Biotin) antibody is Catalog # AAP62697
Datasheets/Manuals Printable datasheet for anti-NUDT2 (ARP62697_P050-Biotin) antibody
Gene Symbol NUDT2
Official Gene Full Name Nudix (nucleoside diphosphate linked moiety X)-type motif 2
Alias Symbols APAH1, MGC10404
NCBI Gene Id 318
Protein Name Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
Description of Target This gene encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene.
Swissprot Id P50583
Protein Accession # NP_671702
Nucleotide Accession # NM_147173
Protein Size (# AA) 147
Molecular Weight 16kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NUDT2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NUDT2.
Protein Interactions MCM6; UBC;
  1. What is the species homology for "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    This target may also be called "APAH1, MGC10404" in publications.

  5. What is the shipping cost for "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NUDT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NUDT2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NUDT2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NUDT2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NUDT2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NUDT2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NUDT2 Antibody - middle region : Biotin (ARP62697_P050-Biotin)
Your Rating