NUDT12 Antibody - C-terminal region (ARP48952_T100)

Catalog No: ARP48952_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-NUDT12 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NUDT12
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIAHQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-NUDT12 (ARP48952_T100) antibody is Catalog # AAP48952 (Previous Catalog # AAPY02076)

Target Info

• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Gene Symbol: NUDT12
• Gene Full Name: Nudix (nucleoside diphosphate linked moiety X)-type motif 12
• Alias Symbols: DKFZP761I172
• NCBI Gene Id: 83594
• Protein Name: Peroxisomal NADH pyrophosphatase NUDT12
• Description of Target: Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-299 CB131118.1 1-299 300-344 BC041099.1 296-340 345-492 CB131118.1 345-492 493-993 BC041099.1 489-989 994-1171 BU621954.1 461-638 1172-3502 BC026748.1 206-2536
• Uniprot ID: Q9BQG2
• Protein Accession #: NP_113626
• Nucleotide Accession #: NM_031438
• Protein Size (# AA): 462
• Molecular Weight: 52kDa
• Protein Interactions: BLMH;