Search Antibody, Protein, and ELISA Kit Solutions

NUDT1 Antibody - middle region (ARP49190_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49190_P050-FITC Conjugated

ARP49190_P050-HRP Conjugated

ARP49190_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NUDT1
Official Gene Full Name:
nudix hydrolase 1
NCBI Gene Id:
4521
Protein Name:
7,8-dihydro-8-oxoguanine triphosphatase
Swissprot Id:
P36639
Alias Symbols:
MTH1
Description of Target:
Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described.
Protein Size (# AA):
197
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NUDT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NUDT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human 8ODP
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%; Zebrafish: 79%
Complete computational species homology data:
Anti-NUDT1 (ARP49190_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELM
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ACY1; UBC; DCUN1D1; COPS5; COPS6; CUL1; CUL2; CUL4B; CUL5; CAND1; RNMTL1; NTHL1;
Blocking Peptide:
For anti-NUDT1 (ARP49190_P050) antibody is Catalog # AAP49190
Datasheets/Manuals:
Printable datasheet for anti-NUDT1 (ARP49190_P050) antibody
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...