Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP73434_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73434_P050-FITC Conjugated

ARP73434_P050-HRP Conjugated

ARP73434_P050-Biotin Conjugated

NUDCD3 Antibody - middle region (ARP73434_P050)

Catalog#: ARP73434_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-160616 from Santa Cruz Biotechnology.
Immunogen The immunogen for Anti-NUDCD3 antibody is: synthetic peptide directed towards the middle region of Human NUDC3
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: AHGSQEAEAPGAVAGAAEVPREPPILPRIQEQFQKNPDSYNGAVRENYTW
Blocking Peptide For Anti-NUDCD3 antibody is Catalog # AAP73434
Datasheets/Manuals Printable datasheet for anti-NUDCD3 (ARP73434_P050) antibody
Target Reference N/A
Gene Symbol NUDCD3
Official Gene Full Name NudC domain containing 3
Alias Symbols NudCL
NCBI Gene Id 23386
Description of Target The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle microtubules, and spindle poles, and loss of gamma-tubulin from spindle poles. The protein localizes to the Golgi apparatus during interphase, and levels of the protein increase after the G1/S transition.
Swissprot Id Q8IVD9
Protein Accession # NP_056147.2
Protein Size (# AA) 361
Molecular Weight 39 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NUDCD3.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NUDCD3.
  1. What is the species homology for "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "NUDCD3 Antibody - middle region (ARP73434_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    This target may also be called "NudCL" in publications.

  5. What is the shipping cost for "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NUDCD3 Antibody - middle region (ARP73434_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NUDCD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NUDCD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NUDCD3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NUDCD3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NUDCD3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NUDCD3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NUDCD3 Antibody - middle region (ARP73434_P050)
Your Rating