NUCKS1 Antibody - middle region : FITC (ARP75743_P050-FITC)

Catalog No: ARP75743_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NUCKS
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: DDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NUCKS1 (ARP75743_P050-FITC) antibody is Catalog # AAP75743
• Reference: N/A

Target Info

• Gene Symbol: NUCKS1
• Gene Full Name: nuclear casein kinase and cyclin dependent kinase substrate 1
• Alias Symbols: JC7, NUCKS
• NCBI Gene Id: 64710
• Protein Name: nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
• Description of Target: This gene encodes a nuclear protein that is highly conserved in vertebrates. The conserved regions of the protein contain several consensus phosphorylation sites for casein kinase II and cyclin-dependent kinases, two putative nuclear localization signals, and a basic DNA-binding domain. It is phosphorylated in vivo by Cdk1 during mitosis of the cell cycle.
• Uniprot ID: Q9H1E3-2
• Protein Size (# AA): 203
• Molecular Weight: 22kDa
• Protein Interactions: UBC; PRCP; GLP1R; RBM42; RBMX; ORC2; ILF3; ELAVL1; MME; AK5;