SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P102230_P050-FITC
Size:100ul
Price: $434.00
SKU
P102230_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-NUCB1 (P102230_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NUCB1
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL
Concentration0.5 mg/ml
Blocking PeptideFor anti-NUCB1 (P102230_P050-FITC) antibody is Catalog # AAP32192
Referencede Alba,E. et al., (2004) Biochemistry 43 (31), 10039-10049
Publications

Valencia, C. A., Cotten, S. W., Duan, J. & Liu, R. Modulation of nucleobindin-1 and nucleobindin-2 by caspases. FEBS Lett. 582, 286-90 (2008). WB, Human 18154733

Sugeno, N. et al. Serine 129 phosphorylation of alpha-synuclein induces unfolded protein response-mediated cell death. J. Biol. Chem. 283, 23179-88 (2008). WB, Human 18562315

Lin, P., Fischer, T., Lavoie, C., Huang, H. & Farquhar, M. G. Calnuc plays a role in dynamic distribution of Galphai but not Gbeta subunits and modulates ACTH secretion in AtT-20 neuroendocrine secretory cells. Mol. Neurodegener. 4, 15 (2009). WB, Human 19320978

Larkin, H., Ribeiro, M. G. & Lavoie, C. Topology and Membrane Anchoring of the Lysosomal Storage Disease-Related Protein CLN5. Hum. Mutat. 34, 1688-97 (2013). WB, Human 24038957

Gene SymbolNUCB1
Gene Full NameNucleobindin 1
Alias SymbolsNUC, CALNUC
NCBI Gene Id4924
Protein NameNucleobindin-1
Description of TargetNucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve DNA-binding and protein-protein interactions.
Uniprot IDQ02818
Protein Accession #NP_006175
Nucleotide Accession #NM_006184
Protein Size (# AA)461
Molecular Weight54kDa
Protein InteractionsREL; UBC; MDM2; CTPS2; RAD23B; PRKDC; METTL1; GTF2I; CBS; XPNPEP1; WARS; PTGS2; XPO1; SET; RBL1; MYC; HIVEP1; GNAS; GNAI3; GNAI1; KLC4; PTGS1; NDN; GNAI2; GNAO1; GNAZ;
  1. What is the species homology for "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    This target may also be called "NUC, CALNUC" in publications.

  5. What is the shipping cost for "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NUCB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NUCB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NUCB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NUCB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NUCB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NUCB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NUCB1 Antibody - C-terminal region : FITC (P102230_P050-FITC)
Your Rating
We found other products you might like!