SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP51318_P050
Price: $0.00
SKU
ARP51318_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NTRK3 (ARP51318_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NTRK3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
Concentration0.5 mg/ml
Blocking PeptideFor anti-NTRK3 (ARP51318_P050) antibody is Catalog # AAP51318 (Previous Catalog # AAPS23407)
ReferenceVerma,R., (2008) Biol. Psychiatry 63 (12), 1185-1189
Description
Gene SymbolNTRK3
Gene Full NameNeurotrophic tyrosine kinase, receptor, type 3
Alias SymbolsTRKC, GP145-TrkC, gp145(trkC)
NCBI Gene Id4916
Protein NameNT-3 growth factor receptor
Description of TargetNTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
Uniprot IDQ16288-3
Protein Accession #NP_002521
Nucleotide Accession #NM_002530
Protein Size (# AA)825
Molecular Weight89kDa
Protein InteractionsTNK2; IRAK3; HSP90AA1; APP; SHC2; KIDINS220; DOK5; RASGRF1; MAPK3; DYNLL1; SQSTM1; SHC1; NGFRAP1; IRAK1; HTR2A; MAPK1; PTPN1; PLCG1; JUN; NTF3; NGFR; FRS2;
  1. What is the species homology for "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NTRK3 Antibody - C-terminal region (ARP51318_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    This target may also be called "TRKC, GP145-TrkC, gp145(trkC)" in publications.

  5. What is the shipping cost for "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "89kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NTRK3 Antibody - C-terminal region (ARP51318_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NTRK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NTRK3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NTRK3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NTRK3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NTRK3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NTRK3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NTRK3 Antibody - C-terminal region (ARP51318_P050)
Your Rating
We found other products you might like!