NTRK2 Antibody - C-terminal region : HRP (ARP51316_P050-HRP)

Catalog No: ARP51316_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Rat, Cow, Horse, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IF, WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 88%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NTRK2 (ARP51316_P050-HRP) antibody is Catalog # AAP51316 (Previous Catalog # AAPP46572)

Target Info

• Gene Symbol: NTRK2
• Gene Full Name: Neurotrophic tyrosine kinase, receptor, type 2
• Alias Symbols: OBHD, TRKB, DEE58, trk-B, EIEE58, GP145-TrkB
• NCBI Gene Id: 4915
• Protein Name: BDNF/NT-3 growth factors receptor
• Description of Target: This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders.
• Uniprot ID: Q8WXJ5
• Protein Accession #: NP_001018075
• Nucleotide Accession #: NM_001018065
• Protein Size (# AA): 553
• Molecular Weight: 57kDa
• Protein Interactions: TNK2; RANBP9; POLR2G; HSP90AA1; AP1B1; NMNAT1; UBC; NTF4; Nedd4; SHC2; KIDINS220; DOK5; SH2B2; SH2B1; SHC3; RASGRF1; UBB; FRS3; GIPC1; NCK2; DYNLL1; SQSTM1; SHC1; NCK1; NTRK2; PTPN1; PTPN11; PLCG1; NTF3; NGFR; FYN; BDNF; TRAF6; PIK3R1; FRS2;