Search Antibody, Protein, and ELISA Kit Solutions

NTRK2 Antibody - C-terminal region (ARP51316_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51316_P050-FITC Conjugated

ARP51316_P050-HRP Conjugated

ARP51316_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Neurotrophic tyrosine kinase, receptor, type 2
NCBI Gene Id:
Protein Name:
BDNF/NT-3 growth factors receptor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
GP145-TrkB, TRKB, trk-B
Replacement Item:
This antibody may replace item sc-113925 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NTRK2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NTRK2.
The immunogen is a synthetic peptide directed towards the C terminal region of human NTRK2
Predicted Species Reactivity:
Cow, Horse, Human, Rabbit, Rat
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 88%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NTRK2 (ARP51316_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DFSWFGFGKVKSRQGVGPASVISNDDDSASPLHHISNGSNTPSSSEGGPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NTRK2 (ARP51316_P050) antibody is Catalog # AAP51316 (Previous Catalog # AAPP46572)
Printable datasheet for anti-NTRK2 (ARP51316_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...