NTNG2 Antibody - middle region (ARP60352_P050)

Catalog No: ARP60352_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-NTNG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NTNG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: YSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESAKGLKEFFT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NTNG2 (ARP60352_P050) antibody is Catalog # AAP60352 (Previous Catalog # AAPP46532)

Target Info

• Gene Symbol: NTNG2
• Gene Full Name: Netrin G2
• Alias Symbols: Lmnt2, NTNG1, NEDBASH, LHLL9381, bA479K20.1
• NCBI Gene Id: 84628
• Protein Name: Netrin-G2
• Description of Target: NTNG2 promotes neurite outgrowth of both axons and dendrites.
• Uniprot ID: Q96CW9
• Protein Accession #: NP_115925
• Nucleotide Accession #: NM_032536
• Protein Size (# AA): 530
• Molecular Weight: 60kDa
• Protein Interactions: Dlg4; EWSR1;