Search Antibody, Protein, and ELISA Kit Solutions

NTN4 Antibody - N-terminal region : FITC (ARP49645_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49645_P050 Unconjugated

ARP49645_P050-HRP Conjugated

ARP49645_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Netrin 4
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ23180, PRO3091
Replacement Item:
This antibody may replace item sc-365280 from Santa Cruz Biotechnology.
Description of Target:
NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants. NTN4 belongs to a family of proteins related to laminins (see LAMA1, MIM 150320) Koch et al. (2000) [PubMed 11038171].[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NTN4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NTN4.
The immunogen is a synthetic peptide directed towards the N terminal region of human NTN4
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NTN4 (ARP49645_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NTN4 (ARP49645_P050-FITC) antibody is Catalog # AAP49645 (Previous Catalog # AAPP29491)
Printable datasheet for anti-NTN4 (ARP49645_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Esseghir,S., (2007) Clin. Cancer Res. 13 (11), 3164-3173

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...