Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NTN4 antibody - N-terminal region (ARP49645_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP49645_P050-FITC Conjugated

ARP49645_P050-HRP Conjugated

ARP49645_P050-Biotin Conjugated

Gene Symbol:
NTN4
NCBI Gene Id:
59277
Official Gene Full Name:
Netrin 4
Protein Name:
Netrin-4
Swissprot Id:
Q9HB63
Protein Accession #:
NP_067052
Nucleotide Accession #:
NM_021229
Alias Symbols:
FLJ23180, PRO3091
Replacement Item:
This antibody may replace item sc-365280 from Santa Cruz Biotechnology.
Description of Target:
NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants. NTN4 belongs to a family of proteins related to laminins (see LAMA1, MIM 150320) Koch et al. (2000) [PubMed 11038171].[supplied by OMIM].
Protein Size (# AA):
628
Molecular Weight:
70kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NTN4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NTN4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NTN4
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NTN4 (ARP49645_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRTAP5-9; CDKN1A; ADAMTSL4; PLSCR1;
Blocking Peptide:
For anti-NTN4 (ARP49645_P050) antibody is Catalog # AAP49645 (Previous Catalog # AAPP29491)
Datasheets/Manuals:
Printable datasheet for anti-NTN4 (ARP49645_P050) antibody
Target Reference:
Esseghir,S., (2007) Clin. Cancer Res. 13 (11), 3164-3173

Tell us what you think about this item!

Write A Review
    Please, wait...