NTHL1 Antibody - middle region (ARP81692_P050)

Catalog No: ARP81692_P050

Host: Rabbit
Target Name: NTHL1
Sample Tissue: Human Testicular Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle terminal region of human NTHL1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NTHL1 (ARP81692_P050) antibody is Catalog # AAP81692

Target Info

• Gene Symbol: NTHL1
• Gene Full Name: nth-like DNA glycosylase 1
• Alias Symbols: FAP3, NTH1, OCTS3, hNTH1
• NCBI Gene Id: 4913
• Protein Name: endonuclease III-like protein 1
• Description of Target: The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity.
• Uniprot ID: P78549
• Protein Accession #: NP_002519.1
• Nucleotide Accession #: NM_002528.5
• Protein Size (# AA): 312
• Molecular Weight: 34 kDa