NT5C3 Antibody - middle region (ARP32185_P050)

Catalog No: ARP32185_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-NT5C3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NT5C3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NT5C3A (ARP32185_P050) antibody is Catalog # AAP32185 (Previous Catalog # AAPP03158)
• Reference: Amici,A., et al., (2002) Genomics Meth. Enzymol. 354,149-159
• Publications:

  The intracellular pyrimidine 5'-nucleotidase NT5C3A is a negative epigenetic factor in interferon and cytokine signaling. Sci Signal. 11, (2018). 29463777

• Description:
  View product citations for NT5C3 Antibody - middle region (ARP32185_P050) on CiteAb

Target Info

• Gene Symbol: NT5C3A
• Gene Full Name: 5'-nucleotidase, cytosolic III
• Alias Symbols: p36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III
• NCBI Gene Id: 51251
• Protein Name: Cytosolic 5'-nucleotidase 3
• Description of Target: Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q9H0P0-1
• Protein Accession #: NP_057573
• Nucleotide Accession #: NM_016489
• Protein Size (# AA): 336
• Molecular Weight: 38kDa
• Protein Interactions: BAG3; VANGL1; NDUFAB1; GNAQ; UBC;