NSMCE3 Antibody - middle region (ARP57727_P050)

Catalog No: ARP57727_P050

WB Suggested Anti-NDNL2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDNL2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NSMCE3 (ARP57727_P050) antibody is Catalog # AAP57727 (Previous Catalog # AAPP44079)

Target Info

• Gene Symbol: NSMCE3
• Gene Full Name: NSE3 homolog, SMC5-SMC6 complex component
• Alias Symbols: HCA4, LICS, NSE3, NDNL2, MAGEG1, MAGEL3
• NCBI Gene Id: 56160
• Protein Name: non-structural maintenance of chromosomes element 3 homolog
• Description of Target: The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene.
• Uniprot ID: Q96MG7
• Protein Accession #: NP_619649
• Nucleotide Accession #: NM_138704
• Protein Size (# AA): 304
• Molecular Weight: 34kDa
• Protein Interactions: EID3; NSMCE1; NSMCE4A; UBC; SMC6; PJA1; TRIM28; NGFR; E2F1;