Search Antibody, Protein, and ELISA Kit Solutions

NSMCE3 Antibody - middle region (ARP57727_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57727_P050-FITC Conjugated

ARP57727_P050-HRP Conjugated

ARP57727_P050-Biotin Conjugated

Gene Symbol:
NSMCE3
Official Gene Full Name:
NSE3 homolog, SMC5-SMC6 complex component
NCBI Gene Id:
56160
Protein Name:
non-structural maintenance of chromosomes element 3 homolog
Swissprot Id:
Q96MG7
Protein Accession #:
NP_619649
Nucleotide Accession #:
NM_138704
Alias Symbols:
HCA4, LICS, NSE3, NDNL2, MAGEG1, MAGEL3
Replacement Item:
This antibody may replace item sc-149223 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene.
Protein Size (# AA):
304
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NSMCE3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NSMCE3.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NDNL2
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NDNL2 (ARP57727_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
EID3; NSMCE1; NSMCE4A; UBC; SMC6; PJA1; TRIM28; NGFR; E2F1;
Blocking Peptide:
For anti-NSMCE3 (ARP57727_P050) antibody is Catalog # AAP57727 (Previous Catalog # AAPP44079)
Datasheets/Manuals:
Printable datasheet for anti-NSMCE3 (ARP57727_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...