Search Antibody, Protein, and ELISA Kit Solutions

NSD2 Antibody - N-terminal region (ARP33489_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33489_P050-FITC Conjugated

ARP33489_P050-HRP Conjugated

ARP33489_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
nuclear receptor binding SET domain protein 2
NCBI Gene Id:
Protein Name:
histone-lysine N-methyltransferase NSD2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-365627 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NSD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NSD2.
The immunogen is a synthetic peptide directed towards the N terminal region of human WHSC1
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Guinea Pig: 88%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 76%; Rat: 86%
Complete computational species homology data:
Anti-WHSC1 (ARP33489_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NSD2 (ARP33489_P050) antibody is Catalog # AAP33489 (Previous Catalog # AAPP04539)
Printable datasheet for anti-NSD2 (ARP33489_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that WHSC1 is expressed in HepG2

Target Reference:
Santra,M., et al., (2003) Blood 101 (6), 2374-2376

Li, J. et al. Identification of a novel proliferation-related protein, WHSC1 4a, in human gliomas. Neuro. Oncol. 10, 45-51 (2008). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18182627

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...