Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NSD2 Antibody - N-terminal region (ARP33489_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP33489_P050-FITC Conjugated

ARP33489_P050-HRP Conjugated

ARP33489_P050-Biotin Conjugated

Gene Symbol:
NSD2
NCBI Gene Id:
7468
Official Gene Full Name:
nuclear receptor binding SET domain protein 2
Protein Name:
histone-lysine N-methyltransferase NSD2
Swissprot Id:
O96031
Protein Accession #:
NP_055734
Nucleotide Accession #:
NM_014919
Alias Symbols:
WHS, TRX5, KMT3F, KMT3G, MMSET, WHSC1, REIIBP
Replacement Item:
This antibody may replace item sc-365627 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences.
Protein Size (# AA):
802
Molecular Weight:
88kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NSD2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NSD2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human WHSC1
Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Guinea Pig: 88%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 76%; Rat: 86%
Complete computational species homology data:
Anti-WHSC1 (ARP33489_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HIST1H3A; HIST3H3; HDAC1; TRIM28; UBC; SF3A1; HNRNPR; MPHOSPH10; RAD50; SART3; NUP93; GTF3C4; NOLC1; DDX21; BAZ1B; DDX18; KHSRP; RRP1; SMARCA5; SMC1A; RBM10; XRCC5; VIM; EZR; TOP2B; TOP1; TMPO; SMARCA4; SFPQ; RPN1; RBBP4; RANGAP1; PTBP1; PRKDC; PLRG1; PKP
Blocking Peptide:
For anti-NSD2 (ARP33489_P050) antibody is Catalog # AAP33489 (Previous Catalog # AAPP04539)
Datasheets/Manuals:
Printable datasheet for anti-NSD2 (ARP33489_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that WHSC1 is expressed in HepG2

Target Reference:
Santra,M., et al., (2003) Blood 101 (6), 2374-2376
Publications:

Li, J. et al. Identification of a novel proliferation-related protein, WHSC1 4a, in human gliomas. Neuro. Oncol. 10, 45-51 (2008). WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18182627

Tell us what you think about this item!

Write A Review
    Please, wait...