NRP1 Antibody - middle region (ARP87034_P050)

Catalog No: ARP87034_P050

Host: Rabbit
Target Name: NRP1
Sample Tissue: Human Mesenchymoma Tumor lysates
Antibody Dilution: 1ug/ml

Host: Rabbit
Target Name: NRP1
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 3ug/ml

Host: Rabbit
Target Name: NRP1
Sample Tissue: Human HT1080 Whole Cell
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRP1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NRP1 (ARP87034_P050) antibody is Catalog # AAP87034

Target Info

• Gene Symbol: NRP1
• Gene Full Name: neuropilin 1
• Alias Symbols: NP1, NRP, BDCA4, CD304, VEGF165R
• NCBI Gene Id: 8829
• Protein Name: Neuropilin-1
• Description of Target: This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. Several alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
• Uniprot ID: O14786-2
• Protein Accession #: NP_001019799.1
• Nucleotide Accession #: NM_001024628.2
• Protein Size (# AA): 644
• Molecular Weight: 70 kDa