Search Antibody, Protein, and ELISA Kit Solutions

NRL Antibody - C-terminal region (ARP58167_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58167_P050-FITC Conjugated

ARP58167_P050-HRP Conjugated

ARP58167_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
neural retina leucine zipper
NCBI Gene Id:
Protein Name:
Neural retina-specific leucine zipper protein
Swissprot Id:
Protein Accession #:
Alias Symbols:
NRL, D14S46E,
Replacement Item:
This antibody may replace item sc-10971 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NRL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NRL.
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NRL (ARP58167_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NRL (ARP58167_P050) antibody is Catalog # AAP58167
Printable datasheet for anti-NRL (ARP58167_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...